PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584285.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 288aa    MW: 33263.3 Da    PI: 6.5077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584285.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.31.9e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd +l ++++  G g+W+  a+  g++R +k+c++rw++yl
   XP_013584285.1 20 KGPWTLEEDTILTNYIAHNGEGRWNVLAKSSGLKRKGKSCRLRWLNYL 67
                     79******************************99************97 PP

2Myb_DNA-binding49.31.1e-1573116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l+++++ q+G++ W++Ia++++ gRt++++k++w++
   XP_013584285.1  73 RGNLTPQEQLLILELHCQWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5081567IPR017930Myb domain
SuperFamilySSF466891.16E-2818114IPR009057Homeodomain-like
SMARTSM007174.3E-121969IPR001005SANT/Myb domain
PfamPF002499.1E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-212174IPR009057Homeodomain-like
CDDcd001672.66E-82267No hitNo description
PROSITE profilePS5129423.77268122IPR017930Myb domain
SMARTSM007174.9E-1372120IPR001005SANT/Myb domain
PfamPF002492.7E-1473116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2275121IPR009057Homeodomain-like
CDDcd001678.64E-1077116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MTSRMKKRCN ENEEGVEQRK GPWTLEEDTI LTNYIAHNGE GRWNVLAKSS GLKRKGKSCR  60
LRWLNYLKPD IKRGNLTPQE QLLILELHCQ WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIDSS SHQFLEAVRS FWVPRLIHKM KDNSNTNTKT PHPDSLGPVD SLGPVSHDSG  180
FNNMGCSTSM SKELTTKMSQ FMDLSDLETT NSMSLKGSRG SSNQCVSEDY CSLPCLEEEY  240
MVPTMGNSDI LPFKDCHVAD SSYEEDVTQD SMWNMDDIWQ FEEYAHFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-24201224105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-24201224105C-Myb DNA-Binding Domain
1msf_C7e-24201224105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15157LKRKGKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAPTransfer from AT1G25340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695657.10.0PREDICTED: transcription factor MYB24-like
RefseqXP_013584285.10.0PREDICTED: transcription factor MYB24
TrEMBLA0A078D6P40.0A0A078D6P4_BRANA; BnaC05g20740D protein
TrEMBLA0A0D3CD880.0A0A0D3CD88_BRAOL; Uncharacterized protein
STRINGBra024760.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.11e-164myb domain protein 116